Functional, multi-objective protein design using continuous relaxation.
WARNING: Unlike BindCraft (which is a well-tested and well-tuned method for generic binder design),
mosaicmay require substantial hand-holding (tuning learning rates, etc), often produces proteins that fail simple in-silico tests, should be combined with standard filtering methods, etc. This is not for the faint of heart: the intent is to provide a framework in which to implement custom objective functions and optimization algorithms for your application. You can read about some applications in our blog.
WARNING: We rely heavily on just-in-time compilation via JAX; the first call to a JAX-compiled function will be slow. After that things should be pretty fast. If you're tuning loss weights or optimizer parameters, you should use an interactive session or a notebook!
Why?
mosaic is an attempt to reimplement a zoo of protein property models with a common interface to make it easier to run them together without dealing with containers, horrible dependencies, etc. Because they're all implemented using the same backend (JAX), they can be efficiently and conveniently connected with code rather than bash scripts. We use this for protein binder design, but there are many applications.
Protein design tasks almost always involve multiple constraints or properties that must be satisfied or optimized. For instance, in binder design one may want to simultaneously ensure:
- the chance of binding the intended target is high
- the chance of binding to a similar off-target protein is low
- the binder expresses well in bacteria
- the binder is highly soluble.
There has been a recent explosion in the application of machine learning to protein property prediction, resulting in fairly accurate predictors for each of these properties. What is currently lacking is an efficient and flexible method for combining these different predictors into one design/filtering/ranking framework.
Models
| Included models |
|---|
| Boltz-1 |
| Boltz-2 |
| BoltzGen (design) |
| AlphaFold2 |
| OpenFold3 |
| ESMFold2 (base, fast, experimental, 2025) |
| Protenix (mini, tiny, base, v1.0, 20250630_v1.0.0, v2.0) |
| ProteinMPNN (standard, soluble, AbMPNN) |
| ESM (2 or C) |
| stability |
| AbLang |
| trigram |
| Proteina-Complexa |
Citing mosaic
If you like mosaic or build on it please cite us:
Boyd, N., Guns, S. & Escalante Bio. Mosaic. https://github.com/escalante-bio/mosaic (2025).
Installation
We recommend using uv, e.g. run uv sync --group jax-cuda after cloning the repo to install dependencies.
To run the example notebook try uv run marimo edit examples/example_notebook.py.
You may need to add various
uvoverrides for specific packages and your machine, take a look at pyproject.toml
You'll need a GPU or TPU-compatible version of JAX for structure prediction. You might need to install this manually, i.e.
uv add jax[cuda12].
Introduction
This project combines two simple components to make a powerful protein design framework:
- A functional, modular interface to easily combine multiple learned or hand-crafted loss terms and optimization algorithms (as in A high-level programming language for generative protein design etc)
- Gradient-based optimization over a continuous, relaxed sequence space (as in ColabDesign, RSO, BindCraft, etc)
The key observation is that it's possible to use this continuous relaxation simultaneously with multiple learned objective terms 1.
This allows us to easily construct objective functions that are combinations of multiple learned potentials and optimize them efficiently, like so:
from mosaic.models.boltz1 import Boltz1 from mosaic.structure_prediction import TargetChain import mosaic.losses.structure_prediction as sp from mosaic.losses.protein_mpnn import InverseFoldingSequenceRecovery from mosaic.proteinmpnn.mpnn import ProteinMPNN from mosaic.optimizers import simplex_APGM import jax import numpy as np boltz1 = Boltz1() mpnn = ProteinMPNN.from_pretrained() target_sequence = "DYSFSCYSQLEVNGSQHSLTCAFE..." binder_length = 80 # Generate features for binder-target complex boltz_features, _ = boltz1.binder_features( binder_length=binder_length, chains=[TargetChain(sequence=target_sequence)], ) # Generate features for binder alone (monomer) mono_features, _ = boltz1.binder_features( binder_length=binder_length, chains=[] ) combined_loss = ( boltz1.build_loss( loss=4 * sp.BinderTargetContact() + sp.DistogramRadiusOfGyration(target_radius=15.0) + sp.WithinBinderContact() + 0.3 * sp.HelixLoss() + 5.0 * InverseFoldingSequenceRecovery(mpnn, temp=jax.numpy.array(0.01)), features=boltz_features, recycling_steps=1, ) + 0.5 * esm_loss + trigram_ll + 0.1 * stability_loss + 0.5 * boltz1.build_loss( loss=0.2 * sp.PLDDTLoss() + sp.DistogramRadiusOfGyration(target_radius=15.0) + 0.3 * sp.HelixLoss(), features=mono_features, recycling_steps=1, ) ) _, PSSM = simplex_APGM( loss_function=combined_loss, n_steps=150, x=jax.nn.softmax( 0.5 * jax.random.gumbel( key=jax.random.key(np.random.randint(100000)), shape=(binder_length, 20), ) ), stepsize=0.1, momentum=0.9, )
Here we're using ~5 different models to construct a loss function: the Boltz-1 structure prediction model (which is used twice: once to predict the binder-target complex and once to predict the binder as a monomer), ESM2, ProteinMPNN, an n-gram model, and a stability model trained on the mega-scale dataset.
It's super easy to define additional loss terms, which are JIT-compatible callable pytrees, e.g.
class LogPCysteine(LossTerm): def __call__(self, soft_sequence: Float[Array, "N 20"], key = None): mean_log_p = jnp.log(soft_sequence[:, IDX_CYS] + 1E-8).mean() return mean_log_p, {"log_p_cys": mean_log_p}
Though a better way to exclude cysteine is to wrap an existing loss, as in NoCys.
WARNING: Optimization is hard: it's quite easy to create an objective function that's difficult to minimize using our standard optimizers. For many design problems you may have to come up with your own heuristic optimization algorithms (for instance by guiding generative models or combining multiple designs).
There's no reason custom loss terms can't involve more expensive (differentiable) operations, e.g. an EVOLVEpro-style fitness predictor.
The marimo notebooks give a few examples of how this can work.
It's very easy to swap in different optimizers. For instance, let's say we really wanted to try projected gradient descent on the hypercube
from mosaic.optimizers import _print_iter, _eval_loss_and_grad def RSO_box( *, loss_function, x: Float[Array, "N 20"], n_steps: int, stepsize: float, max_grad_norm: float, key=None, ): if key is None: key = jax.random.PRNGKey(np.random.randint(0, 10000)) for _iter in range(n_steps): (v, aux), g = _eval_loss_and_grad( x=x, loss_function=loss_function, key=key ) g_norm = np.linalg.norm(g) if g_norm > max_grad_norm: g = g * (max_grad_norm / g_norm) x = (x - stepsize * g).clip(0,1) key = jax.random.fold_in(key, 0) _print_iter(_iter, aux, v) return x
Take a look at optimizers.py for examples.
Structure Prediction
We provide a simple interface in mosaic.structure_prediction and mosaic.models.* to nine structure prediction models: OpenFold3, Boltz1, Boltz2, AF2, ProtenixMini, ProtenixTiny, ProtenixBase, Protenix2025, and ESMFold2.
To make a prediction or design a binder, you'll need to make a list of mosaic.structure_prediction.TargetChain objects. This is a simple dataclass that contains a protein (or DNA or RNA) sequence, a flag to tell the model if it should use MSAs (use_msa), and potentially a template structure (as a gemmi.Chain).
For example, we can make a prediction with Protenix for IL7Ra like so:
import jax from mosaic.structure_prediction import TargetChain from mosaic.models.protenix import Protenix2025 model = Protenix2025() target_sequence = "DYSFSCYSQLEVNGSQHSLTCAFEDPDVNTTNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRT" # generate features and a "writer" object that turns model output into a prediction wrapper target_only_features, target_only_structure = model.target_only_features( [TargetChain(target_sequence)] ) prediction = model.predict( features=target_only_features, writer=target_only_structure, key=jax.random.key(0), recycling_steps=10, ) # prediction contains useful properties like `prediction.st`, `prediction.pae` etc.
This interface is the same for all structure prediction models, so in theory we should be able to replace Protenix2025 above with Boltz2 by changing only a single line of code!
We also define a collection of (model agnostic!) structure prediction related losses here. It's super easy to define your own using the provided interface.
In practice there are three types of structure prediction losses: those that rely on the trunk, structure module, or confidence module. Under JIT, JAX will prune code related to the structure module and confidence module if they're not needed; so if your loss only relies on the trunk it will be quite fast.
Continuing the example above, we can construct a loss and do design as follows:
import mosaic.losses.structure_prediction as sp from mosaic.optimizers import simplex_APGM import numpy as np binder_length = 80 design_features, design_structure = model.binder_features( binder_length=binder_length, chains=[TargetChain(target_sequence)] ) loss = model.build_loss( loss=sp.BinderTargetContact() + sp.WithinBinderContact(), features=design_features, recycling_steps=2 ) PSSM = jax.nn.softmax( 0.5 * jax.random.gumbel( key=jax.random.key(np.random.randint(100000)), shape=(binder_length, 20), ) ) _, PSSM = simplex_APGM( loss_function=loss, x=PSSM, n_steps=50, stepsize=0.15, momentum=0.3, )
Each StructurePrediction object also contains a StructureModelOutput in model_output. This can be useful for inspection, debugging loss terms, and chaining models. For example, to inverse fold directly from a prediction:
import jax from mosaic.structure_prediction import TargetChain from mosaic.models.boltz2 import Boltz2 from mosaic.proteinmpnn.mpnn import load_mpnn_sol from mosaic.losses.protein_mpnn import inverse_fold from mosaic.common import TOKENS boltz2 = Boltz2() features, writer = boltz2.target_only_features([TargetChain(SEQUENCE, use_msa=True)]) pred = boltz2.predict( PSSM=jax.nn.one_hot([TOKENS.index(c) for c in SEQUENCE], 20), features=features, writer=writer, recycling_steps=3, sampling_steps=25, key=jax.random.key(0), ) mpnn = load_mpnn_sol(0.05) ids = inverse_fold( mpnn=mpnn, binder_length=len(SEQUENCE), output=pred.model_output, temp=0.001, key=jax.random.key(0), jacobi_iterations=10, ) print("".join(TOKENS[int(i)] for i in ids))
Every structure prediction model also supports a lower-level feature + losses interfaces if you'd like to do something fancy (e.g. design a protein binder against a small molecule with Boltz or Protenix).
WARNING: AF3-style models (all structure models except for AF2) have at least three input channels related to the binder sequence: the token channel, the MSA, and the reference atomic positions channel. That last one is quite difficult to deal with in a differentiable and JIT-friendly manner during design because each amino acid has a different number of atoms. To get around this we distinguish between two types of features: target-only features and binder features. For binder features (those related to the binder that will be used during design) we use either UNK or G for the reference atomic position channel. This means that predictions using design features do not have sidechains. This doesn't seem to affect performance for most models. If you like sidechains you can repredict your designs with target-only features for both the binder and target.
Protenix
See protenij.py for an example of how to use this family of models. This loss function supports some advanced features to speed up hallucination, namely "pre-cycling" (running multiple recycling iterations on the target alone before design).
ProteinMPNN
Load your preferred ProteinMPNN (soluble or vanilla) model using
from mosaic.proteinmpnn.mpnn import ProteinMPNN mpnn = ProteinMPNN.from_pretrained()
In the simplest case we have a single-chain structure or complex where the protein we're designing occurs as the first chain (note this can be a prediction). We can then construct the (negative) log-likelihood of the designed sequence under ProteinMPNN as a loss term:
from mosaic.losses.protein_mpnn import FixedStructureInverseFoldingLL import gemmi inverse_folding_LL = FixedStructureInverseFoldingLL.from_structure(gemmi.read_structure("scaffold.pdb"), mpnn)
This can then be added to whatever overall loss function you're constructing.
Note that it is often helpful to clip the loss using, e.g., ClippedLoss(inverse_folding_LL, 2, 100): over-optimizing ProteinMPNN likelihoods typically results in homopolymers.
ProteinMPNN + structure prediction
ProteinMPNN can also be combined with live structure predictions. Mathematically this is
ProteinMPNNLoss.
Another very useful loss term is InverseFoldingSequenceRecovery: a continuous relaxation of sequence recovery after sampling with ProteinMPNN (roughly
from mosaic.losses.protein_mpnn import InverseFoldingSequenceRecovery # Include as part of a structure prediction loss loss = model.build_loss( loss=sp.BinderTargetContact() + sp.WithinBinderContact() + 5.0 * InverseFoldingSequenceRecovery(mpnn, temp=jax.numpy.array(0.01)), features=features, )
ESM
Another useful loss term is the pseudolikelihood of the ESM2 protein language model (via esm2quinox), which is correlated with all kinds of useful properties (solubility, expressibility, etc).
This term can be constructed as follows:
import esm import esm2quinox from mosaic.losses.esm import ESM2PseudoLikelihood torch_model, _ = esm.pretrained.esm2_t33_650M_UR50D() ESM2PLL = ESM2PseudoLikelihood(esm2quinox.from_torch(torch_model))
In typical practice this loss should be clipped or squashed to avoid over-optimization (e.g. ClippedLoss(ESM2PLL, 2, 100)).
We also implement the corresponding loss for ESMC (via esmjfold2).
from mosaic.losses.esmc import load_esmc, ESMCPseudoLikelihood # model_name is an alias (esmc_300m / esmc_600m / esmc_6b) or a raw HuggingFace id esmc = load_esmc("esmc_300m") ESMCPLL = ESMCPseudoLikelihood(esmc)
load_esmc converts the checkpoint to JAX via torch + the Biohub transformers fork (both pulled in as dependencies). A pseudo-perplexity variant, ESMCPseudoPerplexity, is also available.
Stability
A simple delta G predictor trained on the megascale dataset. Might be a nice example of how to train and add a simple regression head on a small amount of data: train.py.
from mosaic.losses.stability import StabilityModel stability_loss = StabilityModel.from_pretrained(esm)
AbLang
AbLang, a family of antibody-specific language models.
import ablang import jablang from mosaic.losses.ablang import AbLangPseudoLikelihood heavy_ablang = ablang.pretrained("heavy") heavy_ablang.freeze() abpll = AbLangPseudoLikelihood( model=jablang.from_torch(heavy_ablang.AbLang), tokenizer=heavy_ablang.tokenizer, stop_grad=True, )
Trigram
A trigram language model as in A high-level programming language for generative protein design.
from mosaic.losses.trigram import TrigramLL trigram_ll = TrigramLL.from_pkl()
Optimizers and loss transformations
We include some standard optimizers.
First, simplex_APGM, which is an accelerated proximal gradient algorithm on the probability simplex. One critical hyperparameter is the stepsize, a reasonable first guess is 0.1*np.sqrt(binder_length). Another useful keyword argument is scale, which corresponds to 1.0 encourage sparse solutions; a typical binder design run might start with scale=1.0 to get an initial, soft solution and then ramp up to something higher to get a discrete solution.
simplex_APGM also accepts a keyword argument, logspace, to run the algorithm in logspace, e.g. as an accelerated proximal bregman method. In this case scale corresponds to (negative) entropic regularization: values greater than one encourage sparsity.
batched_simplex_APGM is an internally-vmapped version of simplex_APGM -- useful if you've got a small target or large GPU (or both!), where it can increase throughput several fold.
We also include a discrete optimization algorithm, gradient_MCMC, which is a variant of MCMC with a proposal distribution defined using a taylor approximation to the objective function (see Plug & Play Directed Evolution of Proteins with Gradient-based Discrete MCMC.) This algorithm is especially useful for finetuning either existing designs or the result of continuous optimization.
Loss transformations
We also provide a few common transformations of loss functions. Of note are ClippedLoss, which wraps and clips another loss term.
SetPositions and FixedPositionsPenalty are useful for fixing certain positions of an existing design.
ClippedGradient and NormedGradient respectively clip and normalize the gradients of individual loss terms, this can be useful when combining predictors with very different gradient norms, for example:
loss = ClippedGradient(inverse_folding_LL, 1.0) + ClippedGradient(ablang_pll, 1.0) + 0.25 * ClippedGradient(ESMCPLL, 1.0)
Extensive theoretical discussion
Hallucination-based protein design workflows attempt to solve the following optimization problem:
Here
One challenge with naive approaches is that
ColabDesign, RSO, and BindCraft, among others, use the fact that
This is related to the classic optimization trick of optimizing over distributions rather than single points. First,
$\underset{x}{\textrm{minimize }}f(x)$ is relaxed to$\underset{p \in \Delta}{\textrm{minimize }}E_p f(x)$ . Next, if it makes sense to take the expectation of$x$ (as in the one-hot sequence case), we can interchange$f$ and$E$ to get the final relaxation:$$\underset{p \in \Delta}{\textrm{minimize }} f( E_p x) = \underset{p \in \Delta}{\textrm{minimize }} f(p).$$
Solutions to this relaxed optimization problem must then be translated into sequences; many different methods work here: RSO uses inverse folding of the predicted structure, BindCraft/ColabDesign uses a softmax with ramping temperature to encourage one-hot solutions, etc.
By default we use a generalized proximal gradient method (mirror descent with entropic regularization) to do optimization over the simplex and to encourage sparse solutions, though it is very easy to swap in other optimization algorithms (e.g. projected gradient descent or composition with a softmax as in ColabDesign).
Typically
This kind of modular implementation of loss terms is also useful with modern RL-based alignment of generative models approaches: these forms of alignment can often be seen as amortized optimization. Typically, they train a generative model to minimize some combination of KL divergence minus a loss function, which can be a combination of in-silico predictors. Another use case is to provide guidance to discrete diffusion or flow models.
-
This requires us to treat neural networks as simple parametric functions that can be combined programmatically; not as complicated software packages that require large libraries (e.g. PyTorch lightning), bash scripts, or containers as is common practice in BioML. ↩