
StupidStackLanguage (or SSL) is an esoteric programming language created by Lebster in which all operations take place on a Stack
SSL Uses the characters A-Z to perform actions. SSL is also case-insensitive.
Operations
Note: Items on the stack can only be numbers.
| Character | Operation |
|---|---|
| a | Pushes 0 to the top of the stack |
| b | Pops the 1st item from the stack |
| c | Subtracts the 2nd item on the stack from the 1st item and pushes the result to the stack |
| d | Decrements the 1st item of the stack by 1 |
| e | Pushes the 1st item mod the 2nd item onto the stack |
| f | Prints the 1st item on the stack as an ASCII character |
| g | Adds the first 2 stack items together and pushes the result to the stack |
| h | Gets input from the user as a number and pushes to the stack |
| i | Increments the 1st item of the stack by 1 |
| j | Gets input from the user as a character and pushes that character's ASCII code onto the stack |
| k | Skips the next command if the 1st item on the stack is 0 |
| l | Swaps the 1st and 2nd items on the stack |
| m | Multiplies the first two stack items together and pushes the result onto the stack |
| n | If the 1st item on the stack is equal to the 2nd item, push a 1 to the stack, else push a 0 |
| o | Pops the (first item on the stack)th item on the stack |
| p | Divides the 1st item on the stack by the 2nd item and pushes the result onto the stack |
| q | Duplicates the 1st item on the stack |
| r | Pushes the total length of the stack onto the stack |
| s | Swaps the 1st and (first item on the stack)th items on the stack |
| t | If the 1st item on the stack is 0, jumps to the corresponding 'u' in the program, otherwise does nothing |
| u | If the 1st item on the stack is not 0, jumps back to the corresponding 't' in the program, otherwise does nothing |
| v | Increments the top item on the stack by 5 |
| w | Decrements the top item on the stack by 5 |
| x | Prints the 1st item on the stack |
| y | Deletes the entire stack |
| z | Exits the script |
Examples
Hello World
avqmimcfdddfviiffvddfavdegmfavdmcwfwdddfvddfwdfwdddf
The online interpreter also features macros, so you can compile a "hello world" program using the print macro:
.print("hello world")
Cat
jf
A+B Problem
hhgx
Truth-machine
htxux
Find the Factorial of a Number
hqdtmldubx
h # Set X q # Duplicate x (z) d # Decrement z (y) t # Begin loop m # Multiply y by x l # Swap result and y d # Decrement y u # End loop b # Pop remaining 0 x # Print (x!)
Calculator
hhhtdtdtblpxzubmxzublcxzubgxz
Usage
Takes 3 inputs, X, Y and Z
| Z | Program output |
|---|---|
| 0 | X + Y |
| 1 | X - Y |
| 2 | X * Y |
| 3 | X / Y |
Print the Fibonacci Sequence
# Note: Works best on tio.run as when run via command line it runs so fast that you can't really see any of the numbers. axiqvvdflxlwwltgavvfbxu
Print a box of any character
jfffavvflflqvvvviifblflflfff
Ackermann function
hhaitbltlanlbailtbbbdaiaaubtbdlqdlavdqslobaublubirdubx
hh # read m and n
ait # loop while len(stack) > 1
b # drop stack length
l # n m
t # loop while m != 0
l # m n
anlb # push case2=(n == 0)
ail # push case3=1 to below top of stack
tb # if case2
b # drop case3
b # drop n
d # m -= 1
ai # push n=1
a # push case3=0
aub # endif
tb # if case3
d # n -= 1
l # n-1 m
qdl # n-1 m-1 m
avdqslob # lift 3rd (stack: m-1 m n-1)
aub # endif
l # n m
u
b # drop m (== 0)
i # n += 1
rd # push len(stack)-1
u
b # drop stack length
x # print result
Implementations
Website
You can use the website to run SSL code online. Note that this executes programs slower than the Python interpreter.
Python
There is also a python interpreter, which can be accessed on tio.run
import sys, re
if len(sys.argv) < 2:
print(f"Usage: python {sys.argv[0]} [filename]")
sys.exit(1)
file = open(sys.argv[1], "r")
prg = file.read()
file.close()
stack = []
prg = re.compile("#(?=.*).*").sub("", prg)
prg = re.compile("[^abcdefghijklmnopqrstuvwxyz]*", re.IGNORECASE).sub("", prg)
prgPos = 0
shouldSkip = False
while prgPos < len(prg):
if shouldSkip:
shouldSkip = False
prgPos += 1
continue
char = prg[prgPos].lower()
if char == "a":
stack.insert(0, 0)
elif char == "b":
stack.pop(0)
elif char == "c":
stack.insert(0, stack[0] - stack[1])
elif char == "d":
stack[0] -= 1
elif char == "e":
stack.insert(0, stack[0] % stack[1])
elif char == "f":
print(chr(stack[0]), end="")
elif char == "g":
stack.insert(0, stack[0] + stack[1])
elif char == "h":
stack.insert(0, int(input("\nNumber: ")))
elif char == "i":
stack[0] += 1
elif char == "j":
stack.insert(0, ord(input("\nInput: ")[0]))
elif char == "k" and stack[0] == 0:
shouldSkip = True
elif char == "l":
temp = stack[1]
stack[1] = stack[0]
stack[0] = temp
elif char == "m":
stack.insert(0, (stack[0] * stack[1]))
elif char == "n":
stack.insert(0, int(stack[0] == stack[1]))
elif char == "o":
stack.pop(stack[0])
elif char == "p":
stack.insert(0, stack[0] / stack[1])
elif char == "q":
stack.insert(0, stack[0])
elif char == "r":
stack.insert(0, len(stack))
elif char == "s":
temp = stack[stack[0]]
stack[stack[0]] = stack[0]
stack[0] = temp
elif char == "t":
if stack[0] == 0:
opened = 0
prgPos += 1
while prgPos < len(prg):
if prg[prgPos] == "u" and opened == 0:
break
elif prg[prgPos] == "t":
opened += 1
elif prg[prgPos] == "u":
opened -= 1
prgPos += 1
elif char == "u":
if stack[0] != 0:
closed = 0
prgPos -= 1
while prgPos >= 0:
if prg[prgPos] == "t" and closed == 0:
break
elif prg[prgPos] == "u":
closed += 1
elif prg[prgPos] == "t":
closed -= 1
prgPos -= 1
elif char == "v":
stack[0] += 5
elif char == "w":
stack[0] -= 5
elif char == "x":
print(stack[0], end="")
elif char == "y":
stack = []
elif char == "z":
sys.exit(0)
else:
print("Invalid character:", char, "at", prgPos)
sys.exit(0)
prgPos += 1
Usage
$ python SSL.py [filename]
Where [filename] is the name/path of a file containing the SSL program to execute
Comments can be written as such:
# Comment